PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000666G0490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YA
Protein Properties Length: 250aa    MW: 27333.4 Da    PI: 9.6737
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000666G0490genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.61.8e-32138194158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq Rak e+++kl  k+rkpylheSRh hA++R RgsgGrF
  PH01000666G0490 138 EEPIFVNAKQYHAILRRRQIRAKFEAQNKL-VKGRKPYLHESRHLHAMKRVRGSGGRF 194
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.3E-37136197IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.041137197IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.6E-27139194IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-23140162IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-23171194IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MSNYDFLSGS GYQMKQLGHK IYDQDSSSTK SGRPNQEASA MSDSSLNDQH TSTQSDNYDG  60
HGKLDHDTTR SVLSLGNPEA AFLPPKLNYN QAFACIPYTA DAYYGGVLTG YASHAIVHGQ  120
LNGTTNSRVP LPVEPTAEEP IFVNAKQYHA ILRRRQIRAK FEAQNKLVKG RKPYLHESRH  180
LHAMKRVRGS GGRFLNTKQL EEQKQQQQAA GGASCTKVLG KNICLQSGGP SASAPSRYGE  240
CFNQQRNAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-22138199263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967380.0FP096738.1 Phyllostachys edulis cDNA clone: bphylf045e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.11e-112PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646560.11e-112PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646561.11e-112PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646562.11e-112PREDICTED: nuclear transcription factor Y subunit A-4
TrEMBLW5BMS51e-117W5BMS5_WHEAT; Uncharacterized protein
STRINGMLOC_67781.11e-114(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.14e-39nuclear factor Y, subunit A5